{ }, "action" : "rerender" }, "context" : "envParam:entity", // just for convenience, you need a login anyways... "initiatorBinding" : true, "actions" : [ var watching = false; "actions" : [ "actions" : [ "useCountToKudo" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'brnk6zgqGF5wSGXiWLu6_C3c3H1PAxNxZuIYma72fA8. ], }, }, "event" : "MessagesWidgetCommentForm", "action" : "pulsate" "messageViewOptions" : "1111110111111111111110111110100101001101" "selector" : "#kudosButtonV2_1", { "context" : "envParam:feedbackData", "context" : "lia-deleted-state", "context" : "", "context" : "envParam:selectedMessage", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); } logmein: [76, 79, 71, 77, 69, 73, 78], "useSimpleView" : "false", "actions" : [ { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }); } "event" : "ProductMessageEdit", Monat 24,99 Euro. ] "context" : "envParam:feedbackData", { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234226}); { ] "componentId" : "kudos.widget.button", }, { LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_721b55fde6acb5","nodesModel":{"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Archiv_CallYa|forum-board":{"title":"Board-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_721b55fde6acb5_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); Mit dem CallYa Flex von Vodafone erhalten Kunden einen Prepaid-Tarif, dessen Leistungsumfang flexibel bestimmt werden kann. "action" : "rerender" "action" : "rerender" "context" : "", { "context" : "", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "defaultAriaLabel" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "initiatorBinding" : true, ] "context" : "", }, Vodafone bringt neue CallYa-Tarife an den Start, schneidet parallel alte Zöpfe ab. "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/43476","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vv9qHB9wuqRqeIStJY7wFQvzwgmxNfOUmsDj9ENXWss. { }, "truncateBody" : "true", watching = false; "initiatorBinding" : true, { "action" : "rerender" Sie entscheiden über den Betrag. })(LITHIUM.jQuery); } "action" : "rerender" { "displayStyle" : "horizontal", { "event" : "RevokeSolutionAction", { "forceSearchRequestParameterForBlurbBuilder" : "false", "}); } "linkDisabled" : "false" "disallowZeroCount" : "false", { }, "context" : "", { } "actions" : [ }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "removeMessageUserEmailSubscription", }, "displaySubject" : "true", "context" : "", ] "action" : "rerender" "showCountOnly" : "false", "actions" : [ { "context" : "", // Reset the conditions so that someone can do it all again. "context" : "envParam:feedbackData", "message" : "1594392", } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1594392 .lia-rating-control-passive', '#form_5'); watching = true; "action" : "rerender" }, } ', 'ajax'); "selector" : "#messageview", "event" : "markAsSpamWithoutRedirect", "event" : "deleteMessage", "useSubjectIcons" : "true", } } LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'lB4pnL_-j15wbqSoTsR4i769CzfbEk1KdRk9jO1xlJk. { } "event" : "unapproveMessage", "event" : "removeMessageUserEmailSubscription", Callya Flex – alles Wissenswerte zum app-basierten Prepaid Tarif von Vodafone – Vodafone war einiger der ersten Anbieter, der auf einen Handytarif gesetzt hat, den man mehr oder weniger komplett über eine App steuern konnte. }, { "accessibility" : false, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "useSubjectIcons" : "true", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ '; ], { }, "actions" : [ }, "disallowZeroCount" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1594208,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] { }, ] "displaySubject" : "true", { .attr('aria-expanded','false'); ] "actions" : [ "action" : "rerender" "revokeMode" : "true", "event" : "unapproveMessage", { "parameters" : { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", if ( key == neededkeys[0] ) { { ] "action" : "rerender" }, "actions" : [ } "action" : "pulsate" window.location.replace('/t5/user/userloginpage'); "eventActions" : [ }); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'KwokuPA_O4cMXe9SW4IUo65ZlsiQ6xrZiI1wdp4eiwQ. }, "action" : "rerender" "actions" : [ //resetMenu(); { ] } "action" : "rerender" "action" : "rerender" "context" : "envParam:feedbackData", }, }, } { "disableLinks" : "false", }, }); ] }); "action" : "rerender" } } "messageViewOptions" : "1111110111111111111110111110100101001101" { }, Max Mustermann, Straße Hausnummer, PLZ Ort, Vodafone GmbHKundenbetreuung40875 Ratingen, Sehr geehrte Damen und Herren, hiermit kündige ich meinen Vertrag sofort, ersatzweise zum nächstmöglichen Zeitpunkt. } { { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ }, "action" : "rerender" { "event" : "MessagesWidgetEditCommentForm", "initiatorBinding" : true, { }, "context" : "envParam:quiltName,expandedQuiltName", ] return; } "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" { "event" : "approveMessage", "context" : "", LITHIUM.Dialog.options['-1551472713'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; })(LITHIUM.jQuery); { "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { "dialogContentCssClass" : "lia-panel-dialog-content", var key = e.keyCode; }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", count++; }, ] "event" : "addThreadUserEmailSubscription", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", $('#vodafone-community-header').toggle(); }, { "context" : "", "parameters" : { "action" : "rerender" "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" } "action" : "rerender" "action" : "rerender" } "eventActions" : [ { Wechsel einfach in den Tarif Talk&SMS. Sonst läuft er bei Deinem bisherigen Anbieter weiter. Die Vodafone-Prepaid-Tarife lohnen sich für alle, die flexibel und kostengünstig unterwegs sein wollen. "event" : "MessagesWidgetEditCommentForm", "actions" : [ { { "event" : "MessagesWidgetEditAnswerForm", var key = e.keyCode; } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", Wenn du callya eine Störung per Telefon melden willst, wende dich am besten an die callya Hotline: 08007077130928. ] "actions" : [ "action" : "pulsate" }); { "action" : "rerender" "actions" : [ }, "message" : "1594286", { { { } "event" : "MessagesWidgetEditAnswerForm", //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); }); { "disableLinks" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } { "action" : "rerender" ] { { }, "event" : "MessagesWidgetCommentForm", "kudosLinksDisabled" : "false", }, { } ] { "context" : "", "action" : "rerender" { } "event" : "editProductMessage", { }); ] ] ', 'ajax'); "}); "actions" : [ } { }, $('.css-menu').removeClass('cssmenu-open') "useSimpleView" : "false", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, "event" : "editProductMessage", "selector" : "#messageview_5", ] $('.lia-autocomplete-footer').append(ctaHTML); { // Set start to true only if the first key in the sequence is pressed { } LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditAction", { { } $(this).toggleClass("view-btn-open view-btn-close"); "actions" : [ } } { "actions" : [ "revokeMode" : "true", Du musst nicht gleich kündigen, wenn der Tarif nicht mehr zu Deinen Bedürfnissen passt. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1594286,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "context" : "envParam:entity", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":808,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYNClRQAVMAChgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVXBwdRAVECUhQGVQQDSQEKAQVIV1BcVk9RUVQGAlUHAwYDDANAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "eventActions" : [ "context" : "", { "action" : "rerender" { { if ( key == neededkeys[0] ) { { watching = false; { { "event" : "removeThreadUserEmailSubscription", "context" : "envParam:quiltName,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", ] }, LITHIUM.Dialog.options['-825540353'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ;(function($) { "action" : "rerender" { { "action" : "rerender" "action" : "rerender" .attr('aria-hidden','true') "actions" : [ LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); ] ] }); "actions" : [ "message" : "1594208", { "action" : "rerender" { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "action" : "rerender" } "disallowZeroCount" : "false", "actions" : [ "event" : "addMessageUserEmailSubscription", }, }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1594286,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] }, "parameters" : { ] { { "event" : "MessagesWidgetMessageEdit", } "displayStyle" : "horizontal", "context" : "envParam:entity", { "action" : "pulsate" "truncateBodyRetainsHtml" : "false", "useCountToKudo" : "false", "action" : "rerender" "entity" : "1594286", }, "context" : "envParam:selectedMessage", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "action" : "rerender" }); Execute whatever should happen when entering the right sequence "action" : "rerender" "actions" : [ "actions" : [ ] Du entscheidest, was Du wirklich brauchst. { ] { { "context" : "", { }); "action" : "rerender" ] ] "actions" : [ ] "context" : "", "context" : "", { ] "eventActions" : [ { "context" : "", } }, "event" : "approveMessage", ] } "event" : "unapproveMessage", "actions" : [ }, "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "context" : "", { Tipp: Achte darauf, ob du eine Bestätigung von Vodafone Prepaid für … "event" : "addThreadUserEmailSubscription", "context" : "", "actions" : [ watching = false; "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/43476","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8j5AS5rPtCACJHP1gVud1LdY4Oyhv5b41ekID-1UxHQ. { ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1594351,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { ] ] { LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { var count = 0; }, "actions" : [ { "context" : "", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.